Search
0
Items
Select
Search
MENU
Select

Parathyroid hormone (1-34) (human)

Cat. No. PH-010

Structure:

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Other Names:

PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)

Activity:

Parathyroid hormone receptor agonist
Price Qty
1 mg    £ 125.00

Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland.   Intermittently administered parathyroid hormone (PTH 1-34) has been shown to promote bone formation in both human and animal studies. Parathyroid and its analogues stimulate both bone formation and resorption, and at low doses are in clinical use for the treatment of severe osteoporosis.

Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 138 4607 PMID: 9348185

Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475 PMID: 17369013

Osagie-Clouard et al (2017) Parathyroid hormone 1-34 and skeletal anabolic action: The use of parathyroid hormone in bone formation. Bone Joint Res. 6(1) 14 PMID: 28062525


Related areas

All peptides >
All parathyroid hormone receptor modulators >
All endocrinology research categories >


Technical Data

Structure H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
CAS Number 52232-67-4
Molecular Weight 4117.77
Formula C181H291N55O51S2
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Modifications None

Solubility and Storage

Solubility Soluble to 0.40 mg/ml in water
Appearance Freeze fried solid
Storage Store in the dark, frozen and dessicated

Batch Specific Data

Purity >95%

Contact Information

To place an order, or for customer services, order processing or technical support please contact us on:

UK, Europe and RoW
Tel: (+44) 01392 422205
Fax: (+44) 01392 279510
info@iscabiochemicals.com

USA and Canada

Tel: 610-994-1134

Toll Free: 855-FOCUS21 (855-362-8721)

Fax: 610-465-9100

sales@focusbiomolecules.com 


France

CliniSciences
Tel : +33 9 77 40 09 09
Fax :  +33 9 77 40 10 11
Orders and customer support : info@clinisciences.com


Germany, Switzerland, Austria

BIOZOL Diagnostics 

Tel: +49 (089) 3799 666-6

Fax: +49 (089) 3799 666-99
Orders, Technical and Customer support: info@biozol.de


Italy
Labospace
Tel: +39 02 35980841
Fax +39 02 359808004
Orders: info@labospace.com


Spain and Portugal
Abyntek Biopharma
Tel: +34 94 404 80 80

Fax: +34 94 404 80 81
Orders: info@abyntek.com


China

BIOHUB INTERNATIONAL 

上海起发实验试剂有限公司

Tel: +86-15921799099

Tel: +86-021-50724187

Fax: +86-021-50724961

Orders: sale3@78bio.com

India
BTL Biotechno Labs Pvt Ltd
Tel: +91-8860924629
07291852429
Orders, Technical and Customer support: info@biotechnolabs.com


Japan

Namiki Shoji Co.
Tel:+81-050-5527-9850
Fax:+81-3-3352-2196
email:  globalbusiness1@namiki-s.co.jp


All distributors >