The product has been added to the cart.
By using our website, you agree to our use of cookies. find out more.
-
Products
Pharmacology
Type
- News
- Custom services
- Ordering
- About Us
- Technical support
- Resources
-
Products
Pharmacology
Type
- News
- Custom services
- Ordering
- About Us
- Technical support
- Resources
Exendin-4
Cat. No. GH-001
Structure:
Other Names:
Activity:
Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-induced insulin secretion in isolated rat islets. Exenatide is used to treat type 2 diabetes mellitus as an add-on treatment and has also been evaluated for the treatment of Parkinson's disease.
Eng et al (1992) Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J.Biol.Chem. 267 7402 PMID: 1313797
Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells. J.Biol.Chem. 268 19650 PMID: 8396143
Varin et al (2016) Inhibition of the MAP3 kinase Tpl2 protects rodent and human β-cells from apoptosis and dysfunction induced by cytokines and enhances anti-inflammatory actions of exendin-4. Cell Death Dis. 7 e2065 https://doi.org/10.1038/cddis.2015.399
Related areas
All peptides >
All glucagon and related receptor modulators >
All endocrinology research categories >
All diabetes research categories >
Technical Data
| Structure | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Asn-His-NH2 |
| CAS Number | 141758-74-9 |
| Molecular Weight | 4186.6 |
| Formula | C184H282N50O60S |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Modifications | C terminal amide |
Solubility and Storage
| Solubility | Soluble in water (10mg/mL), PBS, dilute acid and DMSO. |
| Appearance | Freeze dried solid |
| Storage | Store desiccated at -20°C in the dark |
Batch Specific Data
| Purity | >95% by HPLC |
| Safety Data Sheet | Exendin 4 safety data sheet_600eae95e7e8a.DOCX |
Contact Information
To place an order, or for customer services, order processing or technical support please contact us on:
UK, Europe and RoW
Tel: (+44) 01392 422205
Fax: (+44) 01392 279510
info@iscabiochemicals.com
USA and Canada
Tel: 610-994-1134
Toll Free: 855-FOCUS21 (855-362-8721)
Fax: 610-465-9100
France
CliniSciences
Tel : +33 9 77 40 09 09
Fax : +33 9 77 40 10 11
Orders and customer support : info@clinisciences.com
Germany, Switzerland, Austria
BIOZOL Diagnostics
Tel: +49 (089) 3799 666-6
Fax: +49 (089) 3799 666-99
Orders, Technical and Customer support: info@biozol.de
Italy
Labospace
Tel: +39 02 35980841
Fax +39 02 359808004
Orders: info@labospace.com
Spain and Portugal
Abyntek Biopharma
Tel: +34 94 404 80 80
Fax: +34 94 404 80 81
Orders: info@abyntek.com
BIOHUB INTERNATIONAL
上海起发实验试剂有限公司
Tel: +86-15921799099
Tel: +86-021-50724187
Fax: +86-021-50724961
Orders: sale3@78bio.com
India
BTL Biotechno Labs Pvt Ltd
Tel: +91-8860924629
07291852429
Orders, Technical and Customer support: info@biotechnolabs.com
Japan
Namiki Shoji Co.
Tel:+81-050-5527-9850
Fax:+81-3-3352-2196
email: globalbusiness1@namiki-s.co.jp
Recent citations
A new publication from the University of Ljubljana uses MCA-AVLQSGFR-Lys(Dnp)-Lys-NH2, the FRET substrate for the severe acute respiratory syndrome coronavirus main protease (SARS-CoV Mpro), to determine the inhibitory potential of plant polyphenols
Learn moreContact us
Isca Biochemicals
26 Hanover Road
Exeter
EX1 2TL
(+44) 01392 422205
info@iscabiochemicals.com