Peptide YY (Human)

GH-110-1MG 1mg 175.00 GBP

Product specification

Sequence: H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW: 4049.5
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C194H295N55O57
CAS: 118997-30-1
Solubility Soluble in dilute acid
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

PYY, CAS 118997-30-1, is a brain-penetrant Y2R agonist. It is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can reduce appetite and inhibit food intake.

Product Literature References