Oxyntomodulin

GH-070-1MG 1mg 180.00 GBP

Product specification

Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
MW: 4421.86
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C192H295N59O60S
CAS: 62340-29-8
Solubility Soluble in dilute acid
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

Oxyntomodulin is an endogenous glucagon-like peptide that modulates feeding and metabolism and is secreted by intestinal L-cells. It increases cAMP production and inhibits gastric acid secretion in the rat stomach. Oxyntomodulin also inhibits intestinal glucose absorption and reduces fasting ghrelin levels following administration.

Product Literature References