Neuropeptide Y

GH-060-1MG 1mg 125.00 GBP
GH-060-5MG 5mg 495.00 GBP

Product specification

Sequence: H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
MW: 4271.7
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C189H285N55O57S
CAS: 90880-35-6
Solubility Soluble in dilute acid
Long Term Storage: Store dark, frozen and desiccated
Miscellaneous/General:

Neuropeptide Y is ubiquitous neuropeptide involved in a range of biochemicals processes including appetite control, sexual behavior and blood pressure.

Product Literature References

Morales-Medina et al. Brain Research (2010) 1314: 194-205

Holzer et al. Neuropeptides (2012) 46:261-274

Nguyen et al. Curr.Op. Endocrin. Diabetes Obesity (2011) 18: 56-60