LL-37 scrambled human

AM-002-1MG 1mg 125.00 GBP

Product specification

Sequence: H-GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR-OH
MW: 4493.3
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C205H341N61O52
CAS:
Solubility Soluble in dilute acid
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

Scrambled LL-37 is the control peptide for LL-37 [AM-001].

Product Literature References

Currie et.al. PLOS ONE 8(8): e73659