LL-37 Cathelicidin

AM-001-0.5MG 0.5mg 75.00 GBP
AM-001-1MG 1mg 125.00 GBP
AM-001-25MG 25mg 1600.00 GBP
AM-001-5MG 5mg 400.00 GBP

Product specification

Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
MW: 4493.3 Da
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C205H341N61O52
CAS: 154947-66-7
Solubility Soluble in dilute acid and physiological buffers. Soluble in DMSO as stock.
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

LL-37 is a 37 amino acid host defence peptide derived from the C-terminus of the only human cathelicidin, hCAP18. This peptide has been found in many different cell types and body fluids and is linked with antimicrobial, antitumor, antiviral and immunomodulatory properties. LL-37 has also been investigated as a wound-healing agent and is known to inhibit LPS-induced aspects of septic shock. It is known to be involved in transcriptional regulation of melanoma cells.

As a binding parner to Aβ42, LL-37 expression may impact initiation and progression of Alzheimer's disease.

Control scrambled peptide [AM-002] and LL-37 fragments are also available.

Product Literature References