GLP-1 (1-37)

GH-020-0.25MG 250µg 80.00 GBP
GH-020-1MG 1mg 225.00 GBP
GH-020-5MG 5mg 645.00 GBP

Product specification

Sequence: H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
MW: 4169.5
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C186H275N51O59
CAS: 87805-34-3
Solubility Soluble in dilute acid
Long Term Storage: Store dry, frozen and desiccated
Miscellaneous/General:

GLP-1 (1-37), 87805-34-3, is a pancreatic hormone resulting from post-translational proteolysis of proglucagon. GLP-1(1-37) does not effect food intake in rats and does not enhance pancreatic insulin secretion.

Product Literature References