GLP-1 (1-36) amide

GH-030-1MG 1mg 225.00 GBP

Product specification

Sequence: H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4111.5
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C184H273N51O57
CAS: 99658-04-5
Solubility Soluble in dilute acid
Long Term Storage: Store dry, frozen and desiccated
Miscellaneous/General:

GLP-1 (1-36) amide, 99658-04-5, is the posttranslational product of proteolysis of proglucagon (72-107).

Product Literature References