Exendin-4 (5-39) amide

GH-009-1MG 1mg 195.00 GBP

Product specification

Sequence: H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3806.2
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C169H262N44O54S
CAS:
Solubility soluble in dilute acid
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors.

Product Literature References