Exendin-4 (3-39) amide

GH-008-1MG 1mg 200.00 GBP

Product specification

Sequence: H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3992.4
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C176H272N46O58S
CAS: 196109-31-6
Solubility soluble in dilute acid
Long Term Storage: Store dry, dark and frozen
Miscellaneous/General:

Exendin-4 (3-39) amide is a potent GLP-1 receptor antagonist.

Product Literature References