Cecropin B

AM-081-0.2MG 0.2mg 55.00 GBP
AM-081-1mg 1mg 195.00 GBP

Product specification

Sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
MW: 3834.7
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C176H302N52O41S
CAS: 80451-05-4
Solubility Soluble in dilute acid
Long Term Storage: We recommend storage desiccated, frozen and in the dark
Miscellaneous/General:

Cecropin B is a natural linear cationic α-helical antimicrobial peptide (AMP) originally identified in insects.  Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes.  Cecropins constitute a main part of the innate immune system of insects.

Product Literature References

Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. 121(1) 150 doi:10.1016/j.snb.2006.09.044

Hu et al (2013) Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Mol. Cells 35(2) 106 doi:10.1007/s10059-013-2132-0

Yu et al (2016) Combination Effects of Antimicrobial Peptides.  Antimicrob. Agents and Chemother. 60 (3) 1717 DOI: 10.1128/AAC.02434-15