Cecropin B

AM-081-0.2MG 0.2mg 50.00 GBP
AM-081-0.5MG 0.5mg 95.00 GBP
AM-081-1mg 1mg 150.00 GBP

Product specification

Sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
MW: 3834.7
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C176H302N52O41S
CAS: 80451-05-4
Solubility Soluble in dilute acid
Long Term Storage: Store dark, frozen and desiccated
Miscellaneous/General:

Cecropin B is a linear 35 amino acid cationic peptide which exhibits antitumor, antifungal and antibacterial activity against Gram-positive and Gram-negative bacteria.

Product Literature References

Hu et al. Molecules and Cells (2013) 35 106-114