Cecropin A

AM-080-0.2MG 0.2mg 50.00 GBP
AM-080-0.5MG 0.5mg 95.00 GBP
AM-080-1MG 1mg 150.00 GBP

Product specification

Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW: 4003.8
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C184H313N53O46
CAS: 80451-04-3
Solubility Soluble in dilute acid
Long Term Storage: Store dark, frozen and desiccated
Miscellaneous/General:

Cecropin A is a linear 37 amino acid cationic peptide which exhibits antitumor, antifungal and antibacterial activity against Gram-positive and Gram-negative bacteria.

Product Literature References

Kulagina et al. Sens Actuators B Chem. (2007) 121(1): 150–157.