Cecropin A

AM-080-0.2MG 0.2mg 55.00 GBP
AM-080-1MG 1mg 195.00 GBP

Product specification

Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW: 4003.8
Purity: >95% by HPLC
Appearance: Freeze dried solid
Formula: C184H313N53O46
CAS: 80451-04-3
Solubility Soluble in dilute acid
Long Term Storage: We recommend storage desiccated, frozen and in the dark
Miscellaneous/General:

Cecropin A (CeA) is a natural linear cationic α-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic tail at its C-terminus, which allow its interaction with the microbial membrane, and then cell lysis by pore formation. Cecropin A has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens.  Cecropins constitute a main part of the innate immune system of insects.

Product Literature References

Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. 121(1) 150 doi:10.1016/j.snb.2006.09.044

Yu et al (2016) Combination Effects of Antimicrobial Peptides.  Antimicrob. Agents and Chemother. 60 (3) 1717 DOI: 10.1128/AAC.02434-15